PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00092g01520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 80aa    MW: 9616.98 Da    PI: 10.1625
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00092g01520.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.5e-182468147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Peaxi162Scf00092g01520.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                              78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-181871IPR009057Homeodomain-like
PROSITE profilePS5129420.361973IPR017930Myb domain
TIGRFAMsTIGR015571.1E-182271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-102465IPR009057Homeodomain-like
PfamPF002496.6E-152467IPR001005SANT/Myb domain
CDDcd001675.19E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MDPYSSGEEL VVKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KVIRYLSAYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0174831e-115KP017483.1 Petunia x hybrida cultivar Mitchell late elongated hypocotyl (LHY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139035.12e-45hypothetical protein PHAVU_009G259600g
RefseqXP_007139036.12e-45hypothetical protein PHAVU_009G259600g
SwissprotQ6R0H11e-38LHY_ARATH; Protein LHY
TrEMBLA0A151U8C91e-46A0A151U8C9_CAJCA; Myb-like protein G
STRINGPOPTR_0002s18170.13e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.48e-40MYB_related family protein